PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 181aa    MW: 19863 Da    PI: 9.8744
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021254genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.21.8e-4157134178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cq+e+C+adl++ak+yh+rhkvCe h+ka+vv+v+g+ qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++
  DCAR_021254  57 CCQAERCSADLNDAKQYHKRHKVCEYHAKAQVVVVAGVGQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKSSS 134
                  6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.4E-3351119IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.90655132IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.02E-3856135IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3158131IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MENHQRIIKQ EEDMEEGHEF SGNDKKKIRS GNNGARKIGN TGSNVSGGGS GSPPMRCCQA  60
ERCSADLNDA KQYHKRHKVC EYHAKAQVVV VAGVGQRFCQ QCSRFHELSE FDETKRSCRR  120
RLAGHNERRR KSSSDSQGEG GGSSSRKGST AAGGSKDLCG KVQISSMQEN ATTFKHFQIR  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3948131184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002517882.13e-56PREDICTED: squamosa promoter-binding protein 1
SwissprotQ9S7583e-44SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLB9RVW33e-56B9RVW3_RICCO; Squamosa promoter-binding protein, putative
STRINGVIT_12s0028g03350.t011e-55(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-33squamosa promoter binding protein-like 5